PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa001817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 342aa    MW: 36876.6 Da    PI: 7.2093
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-19030PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.45.1e-23157201145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                d+ep+rCrRtDGKkWRC ++v +++k+CErH h+ rsrsrk++++
  Lsa001817 157 DPEPWRCRRTDGKKWRCAKDVGPNQKYCERHAHKTRSRSRKPVDT 201
                79****************************************986 PP

2QLQ51.53e-18106138234
        QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                 FTa+Q+q+L++Q l+yKy++a+ P+Pp+Ll++
  Lsa001817 106 LFTATQWQELERQTLIYKYIMASIPIPPQLLLP 138
                5******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576124No hitNo description
SMARTSM009511.9E-9105141IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.502106141IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.7E-13107138IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.151157201IPR014977WRC domain
PfamPF088791.6E-18158199IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MRNDSNRTSG AAGGGGGGGG GGGCGGAVSP LECDVGLGLN SEPSYPCKKM SLININQYRH  60
HDFGGVYGNN GSQQFVHQGN PTNQLASGIS FKSITDGVVG ASGKVLFTAT QWQELERQTL  120
IYKYIMASIP IPPQLLLPSS TQSNRTSTGI RFSNGSDPEP WRCRRTDGKK WRCAKDVGPN  180
QKYCERHAHK TRSRSRKPVD TTHNPTATSS NQQTRCHEWF IKSSETPLSQ SKMDDCSLSL  240
SMQSSGNVNG NGVEFGDQES FQMAFRMLEG EEESVGDGFR SNHQWLNQAA WEGSNQGSNP  300
SMPGGPLGEA LCLGMSGVDH MGPNVASSYG SYEGSDDRSW FL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070391.19e-46PREDICTED: growth-regulating factor 8 isoform X1
TrEMBLA0A103XJ582e-96A0A103XJ58_CYNCS; Glutamine-Leucine-Glutamine, QLQ